Loading...
Statistics
Advertisement

Julebuyun.com

Home Conversion Technology Metas Server
Julebuyun.com is hosted in China / Beijing . Julebuyun.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Apache/2.2.3 (CentOS).

Technologies in use by Julebuyun.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Javascript

Advertisement

Server Type

  • Apache/2.2.3 (CentOS)

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Julebuyun.com

Missing HTTPS protocol.

    Meta - Julebuyun.com

    Number of occurences: 1
    • Name:
      Content: Close

    Server / Hosting

    • IP: 203.158.16.14
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • dns9.hichina.com
    • dns10.hichina.com
    • mxw.mxhichina.com
    • mxn.mxhichina.com

    Target

    • hostmaster.hichina.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 20 Oct 2016 23:28:41 GMT Server: Apache/2.2.3 (CentOS) Set-Cookie: yunsuo_session_verify=f84e36702d5e5d8dc5e32c46c1886ae9; expires=Fri, 21-Oct-21 07:28:05 GMT; path=/; domain=.julebuyun.com; HttpOnly Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Content-Length: 922 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_fl282 Via: 1.1 s_fl282 (squid/3.5.20) Connection: keep-alive

    DNS

    host: julebuyun.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns9.hichina.com
    host: julebuyun.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns10.hichina.com
    host: julebuyun.com
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: dns9.hichina.com
    5. rname: hostmaster.hichina.com
    6. serial: 2016012819
    7. refresh: 3600
    8. retry: 1200
    9. expire: 3600
    10. minimum-ttl: 360
    host: julebuyun.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 10
    5. target: mxw.mxhichina.com
    host: julebuyun.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 5
    5. target: mxn.mxhichina.com
    host: julebuyun.com
    1. class: IN
    2. ttl: 600
    3. type: TXT
    4. txt: v=spf1 include:spf.mxhichina.com ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ulebuyun.com, www.jzulebuyun.com, www.zulebuyun.com, www.jhulebuyun.com, www.hulebuyun.com, www.jnulebuyun.com, www.nulebuyun.com, www.j.ulebuyun.com, www..ulebuyun.com, www.juulebuyun.com, www.uulebuyun.com, www.jkulebuyun.com, www.kulebuyun.com, www.jlulebuyun.com, www.lulebuyun.com, www.joulebuyun.com, www.oulebuyun.com, www.jlebuyun.com, www.juwlebuyun.com, www.jwlebuyun.com, www.juelebuyun.com, www.jelebuyun.com, www.juslebuyun.com, www.jslebuyun.com, www.jualebuyun.com, www.jalebuyun.com, www.juebuyun.com, www.juluebuyun.com, www.juuebuyun.com, www.jul8ebuyun.com, www.ju8ebuyun.com, www.jul9ebuyun.com, www.ju9ebuyun.com, www.juljebuyun.com, www.jujebuyun.com, www.jul0ebuyun.com, www.ju0ebuyun.com, www.julmebuyun.com, www.jumebuyun.com, www.julpebuyun.com, www.jupebuyun.com, www.juloebuyun.com, www.juoebuyun.com, www.julbuyun.com, www.julexbuyun.com, www.julxbuyun.com, www.julesbuyun.com, www.julsbuyun.com, www.julewbuyun.com, www.julwbuyun.com, www.julerbuyun.com, www.julrbuyun.com, www.julefbuyun.com, www.julfbuyun.com, www.julevbuyun.com, www.julvbuyun.com, www.julecbuyun.com, www.julcbuyun.com, www.juleqbuyun.com, www.julqbuyun.com, www.juleabuyun.com, www.julabuyun.com, www.juleybuyun.com, www.julybuyun.com, www.juleuyun.com, www.julebquyun.com, www.julequyun.com, www.julebwuyun.com, www.julewuyun.com, www.julebzuyun.com, www.julezuyun.com, www.julebxuyun.com, www.julexuyun.com, www.julebuyun.com, www.juleuyun.com, www.julebsuyun.com, www.julesuyun.com, www.julebyuyun.com, www.juleyuyun.com, www.julebeuyun.com, www.juleeuyun.com, www.julebduyun.com, www.juleduyun.com, www.julebcuyun.com, www.julecuyun.com, www.julebyun.com, www.julebuwyun.com, www.julebwyun.com, www.julebueyun.com, www.julebeyun.com, www.julebusyun.com, www.julebsyun.com, www.julebuayun.com, www.julebayun.com, www.julebuun.com, www.julebuyzun.com, www.julebuzun.com, www.julebuyaun.com, www.julebuaun.com, www.julebuysun.com, www.julebusun.com, www.julebuydun.com, www.julebudun.com, www.julebuyun.com, www.julebuun.com, www.julebuycun.com, www.julebucun.com, www.julebuy un.com, www.julebu un.com, www.julebuyn.com, www.julebuyuwn.com, www.julebuywn.com, www.julebuyuen.com, www.julebuyen.com, www.julebuyusn.com, www.julebuysn.com, www.julebuyuan.com, www.julebuyan.com, www.julebuyu.com, www.julebuyunn.com, www.julebuyun.com, www.julebuyunh.com, www.julebuyuh.com, www.julebuyunj.com, www.julebuyuj.com, www.julebuyunk.com, www.julebuyuk.com, www.julebuyunl.com, www.julebuyul.com, www.julebuyun .com, www.julebuyu .com,

    Other Reviews

    1. Marlin Equipment Finance
      Marlin Equipment Finance is a nationwide provider of commercial equipment financing focused on small and mid-size businesses
      United States - 64.47.223.3
      G Analytics ID: UA-6039643-1
      Server software: Microsoft-IIS/7.5
      Technology: AdRoll, Carousel, CSS, Html, Html5, Javascript, Google Analytics, Wordpress
      Number of Javascript: 3
      Number of meta tags: 4
    2. JHE Weddings
      Mountain View (United States) - 172.217.16.211
      Server software: GSE
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Swf Object, Facebook Box, Google +1 Button
      Number of Javascript: 6
      Number of meta tags: 3
    3. Observatoire de la Charte européenne
      France - 51.255.71.169
      Server software: Apache
      Technology: CSS, Fancybox, Html, Html5, Javascript, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Twitter Button
      Number of Javascript: 7
      Number of meta tags: 2
    4. Toledo Commercial Contractors | Toledo Flooring Installers
      Discover why businesses and organizations choose to work with the best commercial flooring and painting contractors in Northwest Ohio - Toledo, Ohio - AFI
      Provo (United States) - 69.195.124.149
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Google Font API, Gravatar, Html, Iframe, Javascript, jQuery, jQuery Validate, MediaElement, Php, Pingback, Revslider, Shortcodes, SVG, WordPress Stats, Wordpress
      Number of Javascript: 35
      Number of meta tags: 7
    5. Alessi for Children
      Dublin (Ireland) - 54.77.4.195
      Server software: Apache
      Technology: CSS, Fancybox, Flexslider, Google Font API, Html, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 13
      Number of meta tags: 3
    6. The Jenny Press
      Mountain View (United States) - 74.125.140.121
      Server software: ghs
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    7. HEM Official Web
      HEM Official Web
      Tokyo (Japan) - 203.189.105.215
      Server software: Apache
      Technology: CSS, Fancybox, Html, Javascript, jQuery, jQuery Fancybox, Php, Pingback, Wordpress, Facebook Box, Google +1 Button, Twitter Button
      Number of Javascript: 11
      Number of meta tags: 2
    8. kellerwilliamsrealtyclarksvilletn.com
      Scottsdale (United States) - 184.168.221.53
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. exquisiteeatery.com
      Dublin (Ireland) - 54.246.93.193
      Server software:
      Technology: CSS, Html
    10. Bootstrap 101 Template
      United Kingdom - 83.223.106.9
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, OSS CDN, AJAX Libraries API, CSS, Html, Html5
      Number of Javascript: 2
      Number of meta tags: 2